Protein Info for PS417_03435 in Pseudomonas simiae WCS417

Annotation: cytochrome P450

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 PF19086: Terpene_syn_C_2" amino acids 18 to 216 (199 residues), 100.3 bits, see alignment E=1.3e-32 PF00067: p450" amino acids 304 to 638 (335 residues), 105.4 bits, see alignment E=3.2e-34

Best Hits

KEGG orthology group: None (inferred from 76% identity to pao:Pat9b_5697)

Predicted SEED Role

"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCF8 at UniProt or InterPro

Protein Sequence (666 amino acids)

>PS417_03435 cytochrome P450 (Pseudomonas simiae WCS417)
MALCGQAPTQQAETLVCWYLWALILDDRIDDGPWAENGVLERFVTAVQAITENDGADPLD
EIGRFDDPMLGVLIDDLWPRTRNWGNERWRHRLVQNLLRHLRAQATLVNMRETGAALTLS
EYLPLRRDSFGALFFFDLIDAAETLDPYQHSADIEWWSRLREHAADIITWTNDIHSIAKD
VVCGERFNLVSILADSAGTDWPASIEAAHQMVNAAVSAFTELAAKHTRQRPSAATDPDRL
RQVARAAGDWHRSVSRYHLQANDPTGRINQQVDLNLTPPTLKSRQFEIDPYPLYERLRTT
LPIVYDEPTDVWLVSRYADVKAALTHPGASSNNYSWQIGPLLGHTLVAMDGCEHAQHRAL
LSPSFRSKALEVLEASITSASMDLLAQMQGRHQVDLIADFTCALPVRVMARALGLPAQTT
EEVEQLKKWCAIGFAYMGNYRQDPTLLTGGLSNRDRFYDFIQPHIDARRTVPTDDLISHL
LAARIDGQPLSEAFVRAYCAILMTAGSETSHGALANLIVNLLDEPGVKEAVMANPDLMDN
ALAETLRRNPPLQLVLREARESLELPSGTIPCGATFACLIGSANRDPDHFTDPDTFNMSR
PHQETNHFAFGAGRHFCLGSILARMEITIGARLLLQTFPGVRWAPGFQPAEHGFLNRCPD
RLEVAL