Protein Info for GFF6751 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF23441: SDR" amino acids 9 to 251 (243 residues), 46 bits, see alignment E=1.1e-15 PF00106: adh_short" amino acids 10 to 202 (193 residues), 200.3 bits, see alignment E=5.8e-63 PF01370: Epimerase" amino acids 12 to 81 (70 residues), 25.4 bits, see alignment E=2.2e-09 PF08659: KR" amino acids 12 to 162 (151 residues), 59.4 bits, see alignment E=1.1e-19 PF13561: adh_short_C2" amino acids 19 to 252 (234 residues), 221.9 bits, see alignment E=2.4e-69

Best Hits

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 92% identity to vpe:Varpa_1318)

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF6751 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MTTMFDLTGKVALVTGGNGGIGLGMAQGLAKAGARVVVAARNAQKSAAAVEALKALGSDS
FALEADVSDEASVQRLFDEAAARCGRLDILINNAGTTVRKPVDQLALSEWHKVMDTNLTS
AFLCSRAAHVHLKAAGGGKIINIGSMMSIFGAPYAPAYAASKAGIVQLTKSTALSWAPDN
IQVNAILPGWFETELTDGARSQIPGLYERVTARAAAGRWGQPADIAGTAVFLASAASDYV
TGTAIPVDGGFSIAG