Protein Info for GFF674 in Xanthobacter sp. DMC5

Annotation: Glutamine transport system permease protein GlnP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 134 to 162 (29 residues), see Phobius details amino acids 190 to 216 (27 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 106.6 bits, see alignment E=4e-35 PF00528: BPD_transp_1" amino acids 35 to 214 (180 residues), 59.6 bits, see alignment E=1.7e-20

Best Hits

Swiss-Prot: 32% identical to GLNP_RICBR: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 88% identity to azc:AZC_4405)

Predicted SEED Role

"polar amino acid ABC transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF674 Glutamine transport system permease protein GlnP (Xanthobacter sp. DMC5)
MNYVFQFGDVFNAWPELLMGAWLTIRLSGLAMMLGLAVAVLCALGKTQGPRPVRWLVDVY
VEVIRNTPFLVQIFLIFFGLPRAGIRLDANEAALLAMVVNAGAYCTEIVRAGIETIHKGQ
IEAGLALGLKRLQIFLYVVLFPALKAIYPSLTSQFILLMLTSSVVSAISAEELTAVANNL
QSQTFRSFEIYIVVTGMYFAMSLMFAGAFALIYRAVFARTDAAR