Protein Info for GFF6736 in Variovorax sp. SCN45

Annotation: Sulfate transporter/antisigma-factor antagonist STAS:Sulphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 376 to 406 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 18 to 362 (345 residues), 211.3 bits, see alignment E=2e-66 PF01740: STAS" amino acids 433 to 524 (92 residues), 41.6 bits, see alignment E=9.2e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to dac:Daci_2661)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>GFF6736 Sulfate transporter/antisigma-factor antagonist STAS:Sulphate transporter (Variovorax sp. SCN45)
MTAEAAPQPTATRRPGLADLVAGVSIAGLLLPEAVAYSGIAGLPPQAGVIALFTGLLVYG
LFGSSRFAIVSATSSSAAVLFAATTSMPGIDMATRLAMGAAIVGLAGVFFVIAGMAKLGA
VSSLIAKPVLRGFALGLALTIVVKQLPKVLAVQPAHSDFFRLIGGLLGEWRHWNLAGAAM
ALVALVLLRGLSRWRAVPAALLVIVAGIALDVSGLCHAWGVAAVGPISLDFSHPGVPQLD
RTQWQNLGGLAFAMALILYAESYGSIRTFAMRHGDNVSANRDLLALGGANMLSALFQGMP
VGAGYSATSANESAGAQSRAAGIVAGLVVGVAVFTLLPWIAHTPEPLLAAIVINAVSHSL
NPSALRPYFHWRRDRLVALVAVAAVLVLGVLDGLLAAIGVSLLLLLRGFSRTTVSWLGRL
GQSHDYVDTARHPEAAVPPGVLIARPEVPLFFGNADAVFASIRARIDATPSLRRMVLSLE
ESSDLDATSIEALCDFAAYVRVRGLRLSLARVKDDVRDLLAKVNSPDLHAEVYAPWSVDD
AVRPDYAPQTGNGQQAPEIRR