Protein Info for GFF6714 in Variovorax sp. SCN45

Annotation: Putative cryptic D-serine deaminase (EC 4.3.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01168: Ala_racemase_N
  • amino acids 59 to 267 (209 residues), 48.4 bits, E=1e-16
• PF14031: D-ser_dehydrat
  • amino acids 323 to 424 (102 residues), 83.6 bits, E=1.2e-27

Best Hits

KEGG orthology group: K01753, D-serine dehydratase [EC: 4.3.1.18] (inferred from 91% identity to vpe:Varpa_1301)

Predicted SEED Role

"low-specificity D-threonine aldolase" in subsystem Serine-glyoxylate cycle or Threonine degradation

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation I (5/8 steps found)
• glycine betaine degradation III (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.18

Protein Sequence (438 amino acids)

>GFF6714 Putative cryptic D-serine deaminase (EC 4.3.1.18) (Variovorax sp. SCN45)
MTMTDTNVTVSNDFTDPLLGSNFKGYPRTQAPRRRSEVGAAGWNVLAGDLPLPLAVLKRE
ALEHNLAWMQSRVREWGIDLAPHGKTTMSPQLFQRQLDAGAWGLTFATVTQLAVGVAAGA
RRTLIANQVVSDEDLAGIQMLLKANAGLRIVFLVDSLAQLALIEDWAARHAGSVPFEVML
EIGVEGARTGCRTHEEAVALATRLRASGAVKLVGIETYEGQGATGASEPDTAYAKTLMDR
VEAVARHCDTHQLFETDEVLVSAGGSAIFDLVAGRLKPALGAPVRGLLRSGCYVTHDHGF
YKRMVSAVDERLGCGCGESLVPAMEVWATVQSRPEPGLAILAVGKRDISFDLSLPVPIAR
AARGALQPAGVPAGWKITALNDQHAYLRWDAGEEAEAPKVGDRVGLGISHPCTTFDKWHW
MPVVENDYRVSDAVAMHF