Protein Info for GFF6702 in Variovorax sp. SCN45

Annotation: Lipoprotein releasing system transmembrane protein LolC/LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 319 to 349 (31 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 418 (414 residues), 468.4 bits, see alignment E=1e-144 PF12704: MacB_PCD" amino acids 30 to 245 (216 residues), 78.2 bits, see alignment E=1.1e-25 PF02687: FtsX" amino acids 278 to 411 (134 residues), 52.2 bits, see alignment E=6.3e-18

Best Hits

Swiss-Prot: 48% identical to LOLC_XYLFA: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 96% identity to vpe:Varpa_1290)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>GFF6702 Lipoprotein releasing system transmembrane protein LolC/LolE (Variovorax sp. SCN45)
MRFPYELQLGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRD
RMLGVVSHIEIFSRDGQALPQLEEIMAAARKHPEVIGAAPFINTQALIARGEDMKGTVVR
GIDPKLEPEVTDTNSIAAHGTFDKLVPGEFGIVLGAELARSLFVQPGDKVTLVAPGGQVT
PAGVVPRLKQFTVVGTFDSGHYEYDSALAMVHEQDAAKVFRLEGPTGIRLKLKDLNEARD
VADQLAVSLPGEFLIRDWTRQNKTWFAAVQVEKRMMFIILTLIVAVAAFNLVSTLVMTVT
DKRADIAILRTLGSSPRSIMGIFVVQGAMVGVIGTVAGLLLGLGIAFNIDVIVPFLEHLF
HASFLPKDIYLISKMPSDPQQSDIVPIAIISLVLSFVATLYPSWRASRVNPAEALRYE