Protein Info for PS417_00340 in Pseudomonas simiae WCS417

Annotation: protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 15 to 293 (279 residues), 350.9 bits, see alignment E=3.5e-109 PF01040: UbiA" amino acids 30 to 278 (249 residues), 238.1 bits, see alignment E=4.8e-75

Best Hits

Swiss-Prot: 92% identical to CYOE1_PSEF5: Protoheme IX farnesyltransferase 1 (cyoE1) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 97% identity to pfs:PFLU0066)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U302 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PS417_00340 protoheme IX farnesyltransferase (Pseudomonas simiae WCS417)
MATLIGARQGQAIWRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALC
AGGAAAVNHVVDRRIDAVMARTHKRPLAEGRVSPLAALAFALFLAVAGLALLLAFTNPLA
AWLTLASLLGYAVIYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGHVSAEPLLLMLII
FAWTPPHFWALAIHRKEEYAKADIPMLPVTHGEHYTKVHILLYTCALLAVSLMPYVIHMS
GPLYLACALLLGGRFLQWAWVLYRGGRPHAAINTFKYSIWYLLLLFIALLLDHYLLLNL