Protein Info for GFF6699 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 113 (1 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 1 to 197 (197 residues), 50.6 bits, see alignment E=2.5e-17 PF00990: GGDEF" amino acids 221 to 371 (151 residues), 95.3 bits, see alignment E=3.6e-31 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 222 to 370 (149 residues), 84.1 bits, see alignment E=4.6e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF6699 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
MIDGVSYGLLAGLMVCGLVLLLVFGALIHGYYVLACAFALLGFAGMNSLAPDDPLAHWAA
AALALWAIFRLQFARQLLRLRHFAPRLDRVAQGVGIALVLTLLYAAAETQLAWTLRAVQG
LLVAATVVLTAGAFIALPRLRWPAVLFCIGALLLLAGISVTRLPVWSEQPWVPGRLNMAQ
AAAIAELAMLALAVGARLRHVLNSAKAQEAHTHALMGAMGTDALTGATSRAGFESRGDEW
LREGRPFSLMLVGLNGFSRVNERHGRAGGDAVLAAIAQRLRQQVRADDMVARLGDDEFAL
LLVGSPTRQKLAEMAIRIETAGATPVTYEGRLLAGGELSMGIACHPADGDTLASLMASAA
EALRHCKQQRMGPAYAFAGEHGGSARGA