Protein Info for GFF6697 in Variovorax sp. SCN45

Annotation: Stringent starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF00462: Glutaredoxin" amino acids 3 to 35 (33 residues), 24.3 bits, see alignment 1e-08 PF02798: GST_N" amino acids 3 to 72 (70 residues), 62.2 bits, see alignment E=1.6e-20 PF13417: GST_N_3" amino acids 4 to 77 (74 residues), 58.7 bits, see alignment E=2e-19 PF13409: GST_N_2" amino acids 9 to 73 (65 residues), 65.4 bits, see alignment E=2.1e-21 PF22441: CLIC-like_N" amino acids 9 to 74 (66 residues), 35.6 bits, see alignment E=3.2e-12 PF00043: GST_C" amino acids 115 to 188 (74 residues), 28.5 bits, see alignment E=5.1e-10 PF13410: GST_C_2" amino acids 120 to 170 (51 residues), 27.6 bits, see alignment E=8.7e-10

Best Hits

Swiss-Prot: 44% identical to SSPA_ECO57: Stringent starvation protein A (sspA) from Escherichia coli O157:H7

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 98% identity to vpe:Varpa_1282)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF6697 Stringent starvation protein A (Variovorax sp. SCN45)
MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLIL
YESNIINEYIDERFPHPQLMPGDPVDRARVRLFLLNFEKELFVHVSTLENRTAKGNDKAL
EKARSHIRDRLTQLAPVFLKNKYMLGDNFSMLDVAIAPLLWRLDYYGIDLSKNAAPLLKY
AERIFSRPAYIEALTPSEKVMRK