Protein Info for GFF6696 in Variovorax sp. SCN45

Annotation: Ubiquinol-cytochrome C reductase, cytochrome C1 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02167: Cytochrom_C1
  • amino acids 39 to 256 (218 residues), 68.6 bits, E=3.2e-23

Best Hits

Swiss-Prot: 43% identical to CY1_ALLVD: Cytochrome c1 (petC) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 92% identity to vap:Vapar_1202)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Protein Sequence (258 amino acids)

>GFF6696 Ubiquinol-cytochrome C reductase, cytochrome C1 subunit (Variovorax sp. SCN45)
MKKKSISGWLAVLGLALGLTFSAAASAESEGIAWDKANTKTNDMAALQNGAKLFVNYCLN
CHSAAFMRYNRLQDIGITEQQIKDNLLFTTDKVGETMKANIDPRQAKDWFGTTPPDLTLV
ARSRAGHGGTGADYLYTYLRTYYRDDTKATGWNNLAFPSVAMPNPLWELQGERRPVYTKV
EQHGHETEVFKGWEQVTPGTLTPVQYDNAVGDLVSYLQWMAEPAQNTRIRIGVWVLLFLA
MSVVFVWRLNASYWKDVK