Protein Info for PS417_03395 in Pseudomonas simiae WCS417

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details PF01810: LysE" amino acids 22 to 210 (189 residues), 110.4 bits, see alignment E=4e-36

Best Hits

KEGG orthology group: None (inferred from 37% identity to rfr:Rfer_3113)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1R4 at UniProt or InterPro

Protein Sequence (212 amino acids)

>PS417_03395 lysine transporter LysE (Pseudomonas simiae WCS417)
MDFFDPAYLGPLVSLALLWTVAVVTPGPNFFNTAQLAASCSRRHGVVASAGVATGTILWG
LAGGLGIKSLFTAAPMLYLAFKIMGGCYLIYLGLKLFRRSAPAMGQGMLSAEARRSLFSA
WRLGLLGNLSNPKAALFVATIFASTMPPSPSPMLLTLAVITMATLSFSWYSCVALVFSSQ
RMADLYSRSRKWLDRFAGGCYLLFGAHLVANR