Protein Info for GFF669 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF02525: Flavodoxin_2" amino acids 1 to 201 (201 residues), 186.8 bits, see alignment E=3.9e-59 PF03358: FMN_red" amino acids 21 to 164 (144 residues), 42.1 bits, see alignment E=6.7e-15

Best Hits

Swiss-Prot: 76% identical to AZOR_ACISJ: FMN-dependent NADH-azoreductase (azoR) from Acidovorax sp. (strain JS42)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 76% identity to ajs:Ajs_2340)

MetaCyc: 41% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF669 FMN-dependent NADH-azoreductase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQLLHIDSAITGDQSVSRQLTAQTVAAWVAAHPGTAVQHLDLAANAPAHLSADALGFRTG
QAAATEAQRQENAVSEALVSQFLAADVVVIGAPLYNFTIPTQLKAWIDRVAQGGRTFKYT
EQGPVGLAGGKTVIVVLSRGGVYSTSEGGRAMEHQETYLQTVLGFFGITDVRFVRAEGVG
MGPDAKAQGLATAESEIRAHVAEAANQPAVAKVA