Protein Info for GFF6684 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00005: ABC_tran" amino acids 17 to 161 (145 residues), 102.3 bits, see alignment E=3.6e-33 PF13304: AAA_21" amino acids 131 to 192 (62 residues), 39.5 bits, see alignment E=6.9e-14

Best Hits

Swiss-Prot: 32% identical to ECSA_BACSU: ABC-type transporter ATP-binding protein EcsA (ecsA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 92% identity to vpe:Varpa_4179)

Predicted SEED Role

"probable ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF6684 ABC transporter, ATP-binding protein (Variovorax sp. SCN45)
MLRASGLTKQYGAHTALDRLDLDIRAGDIYCLLGANGAGKTTTINLFLNFIEPSAGTVEI
NGTDVTRHPVATKQDVAYIPEQVTLYGTLSGLENLRFFAGLALGHELPRKRLLELMTEVG
LDHAAADKRVSAYSKGMRQKVWIAVALAKQAKALLLDEPTSGLDPQAASEFSGLLRRAAD
SGVAVLTTTHDLFHAQQTATRVGIMKRGRLVESLDGEAQIAQTDLQSLYLQHMRA