Protein Info for GFF668 in Methylophilus sp. DMC18

Annotation: Coenzyme PQQ synthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR02108: coenzyme PQQ biosynthesis protein B" amino acids 2 to 313 (312 residues), 423.5 bits, see alignment E=2.1e-131 PF12706: Lactamase_B_2" amino acids 51 to 280 (230 residues), 148.2 bits, see alignment E=1.2e-47

Best Hits

Swiss-Prot: 78% identical to PQQB_METFK: Coenzyme PQQ synthesis protein B (pqqB) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 86% identity to mmb:Mmol_0994)

Predicted SEED Role

"Coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF668 Coenzyme PQQ synthesis protein B (Methylophilus sp. DMC18)
MHIHVLGAGAGGGFPQWNCNCQNCDGLRKGKIKAKRRTQSSICVSSNGIDWVLFNASPDV
LQQIQEFPPLQPGRAIRDSGIQAIILIDAQIDHTTGLFMLREGQVKREIYCTQAVYGDLT
SGNQILNILGHYCGVNHHEIPIDASDISYAHSFEIPNVPNLRFTAVALKSAAPPYSPHRN
DPHPGDTIGVLIEEITTGKKCWYSPGLAEIEPHLPPLMHQADCIMVDGTFWTNTEMLDMG
LMTKTARSIGHNPQSGPGGMIEELDKFGTDKAVRKVLIHINNTNPILREDSAERAILSDH
KIEVAYDGMDIIL