Protein Info for GFF6676 in Variovorax sp. SCN45

Annotation: Ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details PF00909: Ammonium_transp" amino acids 12 to 390 (379 residues), 307 bits, see alignment E=8.8e-96

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_3621)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF6676 Ammonium transporter (Variovorax sp. SCN45)
MDALKQGADALFILLGAIMVLAMHAGFAFLELGTVRKKNQVNALVKILVDFSVSTIVYFL
VGYGVAYGTHFFVSATELSARSGYELVKFFFLLTFAAAIPAIISGGIAERAKFWPQLIAT
AVIVGFVYPLYEGIAWNKHFGIQGWIASLTGHEFHDFAGSVVVHAVGGWLALPAVLLLGA
RRNRYRGDGSLSAHPPSNIPFLALGAWVLCVGWFGFNVMSAQSIDKISGLVAVNSLMAMV
GGTLVALAMGKNDPGFVYNGPLAGLVAICAGSDLMHPLGALVVGGVAGAIFVKMFTLVQN
KWKIDDVLGVWPLHGLCGTWGGIAAGIFGTQALGGIGGVNVWAQLIGTLMGVAWAGLAGW
AVYGALKKAVGLRLTQEEEYDGADLSIHHISATPEREVNW