Protein Info for GFF6665 in Variovorax sp. SCN45

Annotation: Autolysin sensor kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 21 (15 residues), see Phobius details amino acids 30 to 52 (23 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details PF06580: His_kinase" amino acids 145 to 224 (80 residues), 66.9 bits, see alignment E=1.5e-22 PF02518: HATPase_c" amino acids 243 to 336 (94 residues), 39 bits, see alignment E=9.6e-14

Best Hits

KEGG orthology group: None (inferred from 76% identity to vap:Vapar_3612)

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF6665 Autolysin sensor kinase (EC 2.7.3.-) (Variovorax sp. SCN45)
MLRHGLITAVFNCLIATLLSITSGGNWVAHMVYSMSIGIVAWLFIDIGRLLLSGHRESLW
PEWPRGMLLIAAGVAVGFFVGNLIGDAWVGAPTFDFLDLKGHKLATGITITIIAAIGMSF
FFYSLGKSKHMQSQIEVAQRNATEARLKLLETQLEPHMLFNTLANLRVLITVDPPRAVAM
LDRLNSYLRMTLSGSRALSHPLSAEFERLADYLELMSVRMGDRLHYTLELPESLRDAPVP
PLLLQPLVENSIRHGLEPKVEGGEITVRAREDAGQLVIEVSDTGVGLDAAPPSEGSSFGL
EQVRERLATVYGAQGALRLAPTGAGGTCATLNFPLPA