Protein Info for GFF6660 in Variovorax sp. SCN45

Annotation: Multidrug efflux system MdtABC-TolC, membrane fusion component MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 93 to 420 (328 residues), 252.2 bits, see alignment E=3.1e-79 PF25973: BSH_CzcB" amino acids 119 to 251 (133 residues), 33.3 bits, see alignment E=1.1e-11 PF25917: BSH_RND" amino acids 119 to 260 (142 residues), 79.8 bits, see alignment E=3.4e-26 PF25876: HH_MFP_RND" amino acids 158 to 227 (70 residues), 57.4 bits, see alignment E=4.2e-19 PF25944: Beta-barrel_RND" amino acids 264 to 345 (82 residues), 67.4 bits, see alignment E=3.7e-22 PF25967: RND-MFP_C" amino acids 352 to 412 (61 residues), 54.3 bits, see alignment E=3.2e-18 PF25989: YknX_C" amino acids 353 to 420 (68 residues), 44.7 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 73% identity to vpe:Varpa_4153)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>GFF6660 Multidrug efflux system MdtABC-TolC, membrane fusion component MdtA (Variovorax sp. SCN45)
MEQEKPTEPLPANVSPTHPPVRRRRWVGALLTLLLLAILGGGAWYLIQRAKTPAGAPGAA
PGGRPGGPGGAGGPGARGGGGPGGPGGAATSTVGIATAKKADIPVQLEALGTVTPLANVV
VQPQVSGVLTAVLFQEGQMVKKGDVLATIDPQPFQNALAQATGARQRDEAQLAAARVTLS
RYQTLLGQDSIARQDVDTQAALVKQLEGTVAIDRANENTAKLNLTWSRITAPVSGRIGLR
PVDAGNYISTGATNGIATITQITPIDVEFAIPQDRVPEVQDRLAQGAKLDATAFDRTRTR
RLATGAFATLDNLVDTATGTVKAKARFSNADNTLFPNQFVNLRLLLRTVDSAVVVPVTAL
RHGPNGDYVYVLKDDSTVAQRTVTRGEASVDNVAIMSGLTAGEQVVTEGGDRLKDGARVQ
TTVDRPAAPPAGAASGERRGHRGNGERGSGRREGGAAGAGAPSGGAGAGTGAEGAGTRQR
PSSSDSSTPSVPPPAPAVQPGTPPAAPGGTMR