Protein Info for GFF666 in Methylophilus sp. DMC18

Annotation: Histidinol-phosphate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR01141: histidinol-phosphate transaminase" amino acids 17 to 370 (354 residues), 348.4 bits, see alignment E=1.9e-108 PF00155: Aminotran_1_2" amino acids 43 to 359 (317 residues), 194.2 bits, see alignment E=3.8e-61 PF00266: Aminotran_5" amino acids 83 to 204 (122 residues), 26.8 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 71% identical to HIS8_METFL: Histidinol-phosphate aminotransferase (hisC) from Methylobacillus flagellatus

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 79% identity to meh:M301_1189)

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF666 Histidinol-phosphate aminotransferase (Methylophilus sp. DMC18)
MSDLSSDTILSALAPANIRAIAPYQGGKPISELAREMGLNEADIVKLASNENPLGMSPKA
QMAVEEAIDDIARYPDGNSFALRDAVSHKYGVAPSQIVFGNGSNDILELAARAFLSAGDE
VIYSQHAFAVYPLVTQAVGATGVVVPAIDFGHDLPGFLGAMTPKTKMIFVANPNNPTGTL
IPKAILKDFLHQVPKNILVVLDEAYDEYLSATDKSEAIGWLSEFENLIISRTFSKAYGLA
GLRVGFGLMHATLADLMNRVRQPFNVNNLAQIAATVSLQDDDFVARSYAANQAGMAQITQ
GLTQLGLSYIPSFGNFVSFKVTNAGAVNQALLKHGVIVRPVANYEMPDYLRVSIGLFSEN
ARFLDVLEKILKS