Protein Info for GFF6640 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) / ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 PF00005: ABC_tran" amino acids 32 to 193 (162 residues), 93.5 bits, see alignment E=1e-29 amino acids 310 to 460 (151 residues), 109.7 bits, see alignment E=9.7e-35 PF08352: oligo_HPY" amino acids 244 to 298 (55 residues), 29 bits, see alignment 6.3e-10 amino acids 512 to 539 (28 residues), 17.5 bits, see alignment (E = 2.4e-06)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 68% identity to dda:Dd703_1838)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>GFF6640 ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) / ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MTDSNRSAAILEVRGLRVALPSDADRPHAIAQLDLRIEAGRTLCIVGESGSGKSVLATTV
MGLLSKGLVLEGGDVILSGEKLVDNGRFTSDKRLRQLRGTGMGMVFQEPMTALNPVLTCG
EQVDELLRTHTAWGAAERKAHILSIFERVRLPDPARIHASYPHQLSGGQRQRIVIAMAII
LKPRLLICDEPTTALDVTTQAEILKLIAELQAEQGSAVLFITHDMGVVAEIADDVMVMHR
GALVEQGPCDQVLRSPREAYTRMLLDAVPGMTPPPARELPGGRPLLAGQGVGKIYTRRDW
LGRAKHNTALQDASVAVHRGETVGVVGESGSGKSTFARCMIRLISPSAGSILWGDAEVRD
LPEGRLRPLRSRVQVVFQDPNRSLNPRRTVGSSMVEGAMNFGLSKLHARQTAEELMDRIQ
LPRTALDRYPHQFSGGQRQRLAIARAIACQPQVLVADEAVSALDVSVQAQILDLLREIQR
DLGLGILFITHDLRVAAQLCDRVIVMSQGRIVEQGPTGQVFAAPANDYTRRLLAAAPRAE
LASAR