Protein Info for GFF6639 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 197 to 226 (30 residues), see Phobius details PF03591: AzlC" amino acids 21 to 165 (145 residues), 107.1 bits, see alignment E=5e-35

Best Hits

KEGG orthology group: None (inferred from 48% identity to adn:Alide_4273)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>GFF6639 no description (Variovorax sp. SCN45)
MADPEWRGAFAEGRRDIAGAALGTMAMGLVAGVAMAKSGVGLGAILAMSLLVFASASQLA
CLPLIAAGAPLWVIVATACVLNLRFVVFSVSWRRYFGGHRRTQRVLLSYLAGDPVYAQFV
LRHPEPAPSGCATTRQQGYFLGLALTNWAAWHVASLAGIFLADAIPAAWGLRFIGVLALL
ALALPMLTDRAVRCSALAAGMVALATASWPMGLNVVAAIATAFAAGTWADRRWGAR