Protein Info for GFF6634 in Variovorax sp. SCN45

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 865 TIGR01070: DNA mismatch repair protein MutS" amino acids 1 to 856 (856 residues), 982 bits, see alignment E=1.5e-299 PF01624: MutS_I" amino acids 1 to 111 (111 residues), 130.7 bits, see alignment E=8.6e-42 PF05188: MutS_II" amino acids 120 to 251 (132 residues), 57.3 bits, see alignment E=7.2e-19 PF05192: MutS_III" amino acids 267 to 561 (295 residues), 141.6 bits, see alignment E=1.2e-44 PF05190: MutS_IV" amino acids 431 to 521 (91 residues), 104.1 bits, see alignment E=1.2e-33 PF00488: MutS_V" amino acids 617 to 803 (187 residues), 266.2 bits, see alignment E=5.5e-83 PF27441: MutS_C" amino acids 828 to 857 (30 residues), 49.8 bits, see alignment (E = 6.6e-17)

Best Hits

Swiss-Prot: 96% identical to MUTS_VARPS: DNA mismatch repair protein MutS (mutS) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 97% identity to vpe:Varpa_4134)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (865 amino acids)

>GFF6634 DNA mismatch repair protein MutS (Variovorax sp. SCN45)
MMAQYLGLKADHPDTLLFYRMGDFYELFWGDAEKAARLLDITLTQRGQSAGQPVVMCGVP
FHAVDTYLARLIKLGESVAICEQVGEVGASKGPVERKVMRVVTPGTLTDSELLSDKSESL
LLAVHAGSRNFCGLAWLSVTGAELRLAECPADALEAWIARIAPSELLYSAEVTPAFEQRL
KAARSATPFTLSIRPAWQFDGGLGERKLSEQMGSNSLAAWNAESLGNAHAAAAALLGYAE
HTQGRALSHVQRLSVERDGDLIELPPTTRRNLELVQTLRGEESPTMFSLLDTCMTGMGSR
LLKRWLLSPRRDRSEAQERLEAIGALQATVLGGTAAPWRTLREQLKNTSDVERIAARIAL
RQVRPRELLALRLALAKAEQLAPLLPGAAALLARITERLAPPPGCADLLVSAIKPDPSAL
VRDGGVIATGHDAELDELRAISENCDDFLLKLEVSERERTGISNLRVQFNRVHGFYIEVT
QSALSKVPDNYRRRQTLKNAERFITPELKAFEDKALSAQDRALAREKWLYEQLLDALQPS
VPALTQLAGGIATLDALCALAERSHTLHWRAPSFVSHPCIEISQGRHPVVEARLAEKSSG
GFIANDTQLGPQQRMQVITGPNMGGKSTYMRQVAIIVLLASIGSHVPAAACRLGPIDAIH
TRIGAADDLANAQSTFMLEMTEAAQILHSATAQSLVLMDEIGRGTSTFDGLALAAGIAAQ
LHDRSKAFTLFATHYFELTEFPATHHGAVNMHVSATEAGRDIVFLHEMQPGPASKSYGIQ
VARLAGMPAAVVNHARQALEALESQHAQTRAQVDLFAPPPVAETPLVSAVESALAALDPD
AMSPREALDALYALQKLNKRELGAA