Protein Info for GFF663 in Sphingobium sp. HT1-2

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 320 (317 residues), 429 bits, see alignment E=5.3e-133 PF00108: Thiolase_N" amino acids 48 to 145 (98 residues), 34.7 bits, see alignment E=2e-12 PF08545: ACP_syn_III" amino acids 107 to 188 (82 residues), 111.8 bits, see alignment E=1.7e-36 PF08541: ACP_syn_III_C" amino acids 233 to 320 (88 residues), 123.9 bits, see alignment E=3.7e-40

Best Hits

Swiss-Prot: 81% identical to FABH_SPHWW: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 90% identity to sjp:SJA_C1-32390)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF663 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) (Sphingobium sp. HT1-2)
MRRSVLLGTGSALPARVVTNAELAQTVDTSDEWIVERTGIRTRYIAGEGETTTTLATDAA
KRALEAAGLAAQDIDLIILATATPDQTFPASATLVQAALGIEDCVAFDVAAVCSGFLYAM
TVADSMIRSGAAQRALVIGAETFSRILDWEDRATCVLFGDGAGAVVLGAEESADGQRGIL
AAKLHADGRHNQLLYVDGGPSTTQTVGKVRMKGQEVFRHAVVNLATVLKEVMAMAEMTPA
DIDWLVPHQANARILDATARKLKLSPDKVVVTVDQHANTSAASVPLALDAATRDGRIKAG
DLIVLEAMGGGFTWGACVLRV