Protein Info for GFF663 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 51 to 79 (29 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 465 to 486 (22 residues), see Phobius details amino acids 510 to 529 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 68 to 263 (196 residues), 49.5 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 77% identity to pol:Bpro_1149)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>GFF663 Ferric iron ABC transporter, permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLRWLAPALLILLALLLTLPVLSLGFSWFEFDAVARDVLSQMAQTVLPDYALTTLVLCVS
VAIGVALVGMATASAVTLFDFPGRRFFEWALLLPLAMPAYVVAYAYTDFLQFSGPLQVWM
RDAFGLSGRLLPEVRSTSGAVWVFTFSLYPYVYLLARTALAERAAQLMEAARLLGAPLAR
RIREVALPLARPAVAAGVALALMETLADFGVASYFGIQTFTAGIYKAWLAMDNRMAAAQL
ATMLLALVALLMWLEHRAQRRLRFATLRGQRAGSAEAQPTRLHGGRAVCAVLACVLPIAF
GFVLPVLFMLRPLIGGWDDLPWTSFLQWSRNSVWLAGLTAALATAIALALAFALRARPGQ
VTRGVGQLVSLGYAVPGAVIVVGLLLPVGWVQSVWPEASVGYWVTATVLGIVWAYLVRFT
AVALQSMQSGYARIPASLDDSARMLGTTGLGLAARVHWPLLKRSTAAAALLVFVDVMKEL
PATLVLRPFNSDTLAVVAYQLARDERLGEAALPALTLVLVGLVPVILLSRTLRQR