Protein Info for GFF66 in Xanthobacter sp. DMC5

Annotation: Methionine aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00500: methionine aminopeptidase, type I" amino acids 17 to 262 (246 residues), 290.8 bits, see alignment E=4.3e-91 PF00557: Peptidase_M24" amino acids 26 to 254 (229 residues), 176.1 bits, see alignment E=4.2e-56

Best Hits

Swiss-Prot: 55% identical to MAP1_RICPR: Methionine aminopeptidase (map) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 91% identity to xau:Xaut_3053)

MetaCyc: 48% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF66 Methionine aminopeptidase (Xanthobacter sp. DMC5)
MNYVEAANAPLRKTGHIKLYGPEGFEGMRRAGALTAKALDAVAEMIGPGVTTTAIDELIF
DFAMDHGAYPATLMYRGYRYSVCTSVNHVVCHGMPNARPLRDGDIVNVDVTLVVDGWYGD
SSRMFPVGAIPRRAERLLDVTYESMMRGIRAIRPGAHVGDIGAAIQEFVEPQHMSVVRDF
CGHGVGQVFHDEPNIVHVGRRGEGPKLVPGMIFTVEPMINLGRPHVKVLSDGWTAVTRDR
SLSAQFEHAVGVTETGVEIFTLSPKGYHKPPYITA