Protein Info for GFF66 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: H(+)/Cl(-) exchange transporter ClcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 320 to 348 (29 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 91 to 436 (346 residues), 329.2 bits, see alignment E=1.6e-102

Best Hits

Swiss-Prot: 100% identical to CLCA_SALTY: H(+)/Cl(-) exchange transporter ClcA (clcA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to stm:STM0203)

MetaCyc: 78% identical to chloride:H+ antiporter ClcA (Escherichia coli K-12 substr. MG1655)
RXN0-2501

Predicted SEED Role

"H(+)/Cl(-) exchange transporter ClcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF66 H(+)/Cl(-) exchange transporter ClcA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTLTGLVGVAFEKAVSWV
QNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEAGGSGIPEIEGALEELR
PVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVLDVFRMRSAEARHTLLAT
GAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGVIMSSIVFRIFNGEAPIIE
VGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQRFHGGEIKKWVLMGGAIGG
LCGILGLIEPAAAGGGFNLIPIAAAGNFSVGLLLFIFITRVVTTLLCFSSGAPGGIFAPM
LALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMAASVRAPLTGIVLVLEMTDNYQ
LILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDAEQAEKNQNAPADENT