Protein Info for PS417_03340 in Pseudomonas simiae WCS417

Annotation: gluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 109 to 141 (33 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 348 to 363 (16 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details amino acids 430 to 454 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 16 to 451 (436 residues), 446 bits, see alignment E=1.4e-137 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 18 to 452 (435 residues), 414.2 bits, see alignment E=3.6e-128 PF03600: CitMHS" amino acids 27 to 401 (375 residues), 64 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 43% identical to GNUT_PSEAE: Gluconate permease (gnuT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 97% identity to pfs:PFLU0695)

MetaCyc: 39% identical to high-affinity gluconate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-209

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVX4 at UniProt or InterPro

Protein Sequence (456 amino acids)

>PS417_03340 gluconate transporter (Pseudomonas simiae WCS417)
MELSTAVWMVHDTRLMFCVLLAIASIIVLISATKLPPFLSILIGTFIAGVGAGLPPEEVA
KAFSKGAGAILGEAGIIIALGSMLGALMAESGAADRIATTLLGLGKGKALPWVMALVAMV
IGLPLFFEVGLVMMVPIILVMAKRSNQPLLKIAIPALAGMTTLHALMPPHPGPLIAVSAL
HADLGLTMLLGFCLAVPAVILAGPIYGNWLSKRLHVDEPADIGALFSAPPKAPRQPSFTV
SLLIILLPVILMLGSTLAKVALPAESAIGLTLKFLGEPLIALGLAVVAAVICLGWAAGMP
RAEVGNTLRKALAPIAVLLLTIGAGGGLKQTLLDAGVSQTISKVAEGAHMPYLLLAWLIA
VALRQATGSATVATTTTAGILAPMMAGLAAPQSSLVALAIGAGSVFFCHVNDAGFWMVRE
YFGLQLKQTIWVWSVLQTIVSVVGLVGTLLLWHFLT