Protein Info for GFF6574 in Variovorax sp. SCN45

Annotation: Conjugative transfer protein TrbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details TIGR02783: P-type conjugative transfer protein TrbL" amino acids 1 to 304 (304 residues), 220.1 bits, see alignment E=2.1e-69 PF04610: TrbL" amino acids 37 to 256 (220 residues), 174.6 bits, see alignment E=1.3e-55

Best Hits

KEGG orthology group: K07344, type IV secretion system protein TrbL (inferred from 84% identity to adn:Alide_2829)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF6574 Conjugative transfer protein TrbL (Variovorax sp. SCN45)
MNDVTVIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTLAGLFWALGHASGEGEDV
IAKLLRKVLYVGAFAYIIGNFNQLAGIVFRSFAGLGLTASGSTLSMGNFLQPGRLAKAGI
EAGAPILQQIGDMAGFPEVFVNIAPIVVLFLAWFIVILCFFVLAVQLFVTLIEFKLTTLA
GFVLVPFALWNKTAFLAEKVLGNVVSSGIKVLVLAVIVGVGTGLFAEFKVHPSEPSIDHA
LVVMLASLALLALGIFGPGIATGLVSGGPQLGAGAMAGATLGTAGAAIGVGAAAAGVGGA
VAAGARMAPAAARSMASTASSAKSAFQAGSASAGGGLKGAAAGLGNVAKTGAQAAGQKVA
DGARSIRERAAAAFSSEAPASGSAASSSDAPSASAQEQPAWAKRLHRRQQLTHAATTTAH
ALRGGDGGSSSSGPSLRDSDS