Protein Info for GFF6547 in Variovorax sp. SCN45

Annotation: Glutathione S-transferase (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 21 to 99 (79 residues), 50.9 bits, E=5e-17
• PF13417: GST_N_3
  • amino acids 23 to 101 (79 residues), 38.2 bits, E=4.3e-13
• PF13409: GST_N_2
  • amino acids 29 to 99 (71 residues), 48 bits, E=4.7e-16
• PF00043: GST_C
  • amino acids 144 to 222 (79 residues), 34.6 bits, E=5.5e-12
• PF13410: GST_C_2
  • amino acids 151 to 217 (67 residues), 29.9 bits, E=1.5e-10
• PF14497: GST_C_3
  • amino acids 152 to 225 (74 residues), 25 bits, E=5.6e-09

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 91% identity to vap:Vapar_3732)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (234 amino acids)

>GFF6547 Glutathione S-transferase (EC 2.5.1.18) (Variovorax sp. SCN45)
MTDLSSFPITKKWPAQHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVSFETNDQMSP
EFLSLNPNNKIPAILDPDGPGGKPLALFESGAILVYLAEKTGKLIPQDAAGRYQTLQWVM
FQMGGIGPMFGQLGFFNKFAGKDYEDKRPRDRYVGESKRLLGVLDKHLANREWIMGDSYT
IADIATFPWIRNLVGFYEAGELVGFKDFANVARVLEAFVARPAVVKGLGIPKRG