Protein Info for GFF6546 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR03571: luciferase-type oxidoreductase, BA3436 family" amino acids 7 to 310 (304 residues), 337.7 bits, see alignment E=3.3e-105 PF00296: Bac_luciferase" amino acids 27 to 235 (209 residues), 106.1 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 60% identity to smt:Smal_2279)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF6546 hypothetical protein (Variovorax sp. SCN45)
MPPFNAAYRQTLLAGRLTLGLMTPVARANGAMADPEAERDIAALADRLGFAALWTRDVPV
MVPQGDEISVLDEPFAWLTMLAGATRRIALGTAAAVLPLRHPLHVAKSALSVNRLSGERF
IFGLGSGDREAEFAIFRQDIALRGDAFRERWSLVRSALSPDAAGRAALREATGGHDLMAP
PAERIGMLVVGSARQSLQWTAAHADGWATYHRDEARQQGRIGLWQTALRERAGSEAKPFI
QSLQIDLLENPAAPAEPIELGLRTGRDALVAYLDRMEDAGVAHVLMNVVRGPRPAAEVVD
ELGREVLPRLQGHARTPAA