Protein Info for GFF6536 in Variovorax sp. SCN45

Annotation: protein of unknown function DUF1345

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details PF07077: DUF1345" amino acids 36 to 209 (174 residues), 212.2 bits, see alignment E=2.3e-67

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_4305)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF6536 protein of unknown function DUF1345 (Variovorax sp. SCN45)
MQEHLSTTTGPQRLLYGGLVGAAVAMVPWSMSGMARGLAGWCAGVLVYQVLTWWLADTFD
ARRTRERAQSLDQPNVVILVSMLVAVGVSVVAIAMLLQQVKQLNGWERIAHVALGLVALA
GSWLMMHSIYAFHYAHRYYIDQKGGRPDGGLDFPGKDDAPDYFDFLYYSYVIGMTSQVSD
VQATSKEMRRITLIHSVLSFTFNMMVLALSVNVVAGAFS