Protein Info for GFF6535 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF00892: EamA" amino acids 30 to 155 (126 residues), 78.5 bits, see alignment E=3e-26 amino acids 173 to 305 (133 residues), 72.2 bits, see alignment E=2.8e-24

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_4304)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF6535 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MSTTNNNIPATAIAPAAPASASAAWLVDLVLLGALWGASFLFMRIGAAEFGALPAAAVRV
AIASLFLLPIALLRGQGPTIAKHWKASFAVGVFNSGLPFALFCFALLSINSGLAAVLNAT
TPMFGALVAWAWFRERPAGSRIVGLVIGFAGVAMLASRSAGVHAGATGHAALWAVLACLG
ACLCYGISASATRRHLGGVPALTTATGSQIGATLFLAIPAFMLWPTQMPSLRAWLALLAL
GIACTGIAYILFFRLIERAGPARALTVTFLVPVFALFYGAVFLDEHITQWMLICAAVIVC
GVALSTGVVKFGWPRKAAA