Protein Info for GFF6533 in Variovorax sp. SCN45

Annotation: Methylphosphotriester-DNA--protein-cysteine S-methyltransferase (EC 2.1.1.n11) / DNA-3-methyladenine glycosylase II (EC 3.2.2.21)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 PF02805: Ada_Zn_binding" amino acids 16 to 79 (64 residues), 99.3 bits, see alignment E=2.4e-32 PF12833: HTH_18" amino acids 120 to 198 (79 residues), 88.7 bits, see alignment E=6.4e-29 PF06029: AlkA_N" amino acids 214 to 342 (129 residues), 94.2 bits, see alignment E=1.7e-30 PF00730: HhH-GPD" amino acids 348 to 477 (130 residues), 38.4 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 90% identity to vap:Vapar_3726)

Predicted SEED Role

"ADA regulatory protein" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>GFF6533 Methylphosphotriester-DNA--protein-cysteine S-methyltransferase (EC 2.1.1.n11) / DNA-3-methyladenine glycosylase II (EC 3.2.2.21) (Variovorax sp. SCN45)
MPTSHTPTEALESDACYLAMKTHDARFDGSFFTAVTSTGIYCRPVCRVKLPRRENCRFFR
HAAQAEAAGFRPCLRCRPELAPRAASWSTEDASRILALQAARLIDEPDAWSEDGPGAAQI
AARLGVSDRHLRRIFEAQFGVSPLQYLQTRRLLAAKQLIADTRLPMTQVALASGFASVRR
FNAAFVEHYGLNPSALRRAGGEAVEGGESRAIEVRLGFRPPYDDNAMLGFFARRALRGIE
VVATADGKEPAKGSTAAYVKLARTLRIQQGNQAHAGWLQLRFDLEREQVLLSVSDSLAAV
LPIVISRARALFDLDAEPMAINTALHAAFPHGDGLRVPGAVDGFELAVRAVLGQQITVAA
ARTLGSRLVAAFGETIATPIEGLDRLFPTPAAIAQASGDALGQLGIVRQRQAALQAIARE
VAEGRLALHAGADVPSTIAALQELPGIGAWTAQYIAMRALRWPDAFPAGDVALQKALGVT
TARAASEASQAWRPWRSYAVLRAWHAPSAPATAATAASPLITTAGLTA