Protein Info for GFF6528 in Variovorax sp. SCN45

Annotation: Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF01135: PCMT" amino acids 14 to 197 (184 residues), 88.7 bits, see alignment E=1.7e-28 PF00398: RrnaAD" amino acids 66 to 141 (76 residues), 36.8 bits, see alignment E=8.9e-13 PF13847: Methyltransf_31" amino acids 84 to 166 (83 residues), 29.3 bits, see alignment E=2.4e-10 PF13649: Methyltransf_25" amino acids 89 to 164 (76 residues), 36.5 bits, see alignment E=2.4e-12 PF08242: Methyltransf_12" amino acids 90 to 164 (75 residues), 30.7 bits, see alignment E=1.6e-10 PF08241: Methyltransf_11" amino acids 90 to 162 (73 residues), 34.4 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 92% identity to vpe:Varpa_4296)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF6528 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (Variovorax sp. SCN45)
MNPTPTLERLRFNMIEQQIRPWDVLETDILELLAEIHREDYVPDEHRTLSFFDMELPLLD
GSVPGEFMLSPKVEARTLQDLHIQKHESVLEIGTGSGFMAALLGARAAQVLSLEINPVLA
ARAAETLRQNGVTNVEVRHADGSVPLASGPSFDVIVLSGSVARIPQNLLGSLKVGGRLSA
IVGDEPMMRAHFVTRTSESKWDTTQPWDTVAPRLLNFPEPSRFSF