Protein Info for PS417_03300 in Pseudomonas simiae WCS417

Annotation: alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 14 to 144 (131 residues), 143.5 bits, see alignment E=2e-46 PF00583: Acetyltransf_1" amino acids 17 to 122 (106 residues), 52.7 bits, see alignment E=1e-17 PF13673: Acetyltransf_10" amino acids 40 to 128 (89 residues), 47.9 bits, see alignment E=2.7e-16 PF13508: Acetyltransf_7" amino acids 42 to 124 (83 residues), 47.6 bits, see alignment E=3.5e-16 PF08445: FR47" amino acids 64 to 125 (62 residues), 33.9 bits, see alignment E=5.3e-12

Best Hits

Swiss-Prot: 43% identical to RIMI_ECO57: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli O157:H7

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 99% identity to pfs:PFLU0684)

MetaCyc: 43% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXK1 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PS417_03300 alanine acetyltransferase (Pseudomonas simiae WCS417)
MSEALSFRPMTEADLDAVLKIEYAAFSHPWTRGIFLDGLGKYQIWLMFEGEQQVGHGVVQ
IILDEAHLLNITVKPENQGRGLGLALLEHLMSRAYAASARECFLEVRDSNTGAFRLYERY
GFNEIGRRRDYYPAIGGREDAVVMACTLVD