Protein Info for GFF650 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Galactokinase (EC 2.7.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR00131: galactokinase" amino acids 5 to 382 (378 residues), 567.2 bits, see alignment E=8.3e-175 PF10509: GalKase_gal_bdg" amino acids 10 to 58 (49 residues), 79.5 bits, see alignment 1.6e-26 PF00288: GHMP_kinases_N" amino acids 94 to 182 (89 residues), 76.8 bits, see alignment E=1.9e-25 PF08544: GHMP_kinases_C" amino acids 279 to 361 (83 residues), 49.4 bits, see alignment E=7.7e-17

Best Hits

Swiss-Prot: 100% identical to GAL1_SALTY: Galactokinase (galK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 98% identity to ses:SARI_02168)

MetaCyc: 91% identical to galactokinase (Escherichia coli K-12 substr. MG1655)
Galactokinase. [EC: 2.7.1.6]

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF650 Galactokinase (EC 2.7.1.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNLKEKTRALFAEIFGYPATHTIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRD
DRTVRVIAADYDNQVDEFSLDAPIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGN
VPQGAGLSSSASLEVAVGTVFQQLYHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISAL
GKKDHALLIDCRTLGAKAVSMPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQP
ALRDVSLEAFNAVASELDPVVAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHAS
MRDDFEITVPQIDTLVDIVKATIGDRGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQY
EAKTGIKETFYVCKPSQGAGQC