Protein Info for GFF648 in Variovorax sp. SCN45

Annotation: integral membrane sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 33 to 57 (25 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details PF00512: HisKA" amino acids 258 to 324 (67 residues), 46.8 bits, see alignment E=2.4e-16 PF02518: HATPase_c" amino acids 368 to 477 (110 residues), 85.3 bits, see alignment E=4.1e-28

Best Hits

KEGG orthology group: None (inferred from 48% identity to pct:PC1_2700)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>GFF648 integral membrane sensor signal transduction histidine kinase (Variovorax sp. SCN45)
MSLDALGALARAPRRLLRNLWGRLRRPSLVRRLMFAQIGMMTLLWSVAVALLLGSAMIDD
LSTLDASQRSMLTVARNLTDQPAKQYESLRAMDLALRNAFGSGNDATLSPSVIVWQNGRE
IYRSDGVPSGISNTRPDIGETVEADGKSWRARTIESPTGKTRVTLITPGGMQIWLTFQTR
GYYVLPLIISVPFLLLPAWLSIRLALRPWRKVAREIASRGPHDLAPVTALPRHEELLPLV
HNFNALMDRLRASIAREQSFIADAAHELRTPIAAMRVNVEALQSLLTQHIPTERQHELFA
RVLNSNARAERLVGQLLRLMRSNAQASAPGPLRLDDLLQERLAALSALAHVREVEIELVT
DEPVEIAGDRDSLVSMIDNLIDNATKYSPVGSTVSVGIRRVGNEAVLTVADQGPGIMPAL
RERVFDRFFRDPDQTQTGSGLGLAIVRAVIDAHGGTIALDGTGLGPGLQVTVRLPLAGAS
SPGAFGPLGPLGAVTPAES