Protein Info for GFF648 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: UPF0301 protein YqgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF02622: DUF179" amino acids 19 to 182 (164 residues), 167.3 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 74% identical to Y1142_POLSJ: UPF0301 protein Bpro_1142 (Bpro_1142) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 74% identity to pol:Bpro_1142)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>GFF648 UPF0301 protein YqgE (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSADFAPINLTNHFLIAMPGLSDELFGRSVVFMCEHSERGALGLVINKPSDILLSRLFEK
VDLPMGRDDLATLPVFQGGPVQTERGFVLHEAVSGEGESVYASTLSIPGGLEMTTSKDVL
EAMASGAGPRRVFVSLGYASWGQGQLESEITENSWLTVEADPNLIFDAPVAERYERAMAL
LGLQPWMLSPDAGHA