Protein Info for GFF6476 in Variovorax sp. SCN45

Annotation: Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR00528: glycine cleavage system T protein" amino acids 12 to 384 (373 residues), 323.9 bits, see alignment E=6e-101 PF01571: GCV_T" amino acids 16 to 262 (247 residues), 272.7 bits, see alignment E=2.8e-85 PF08669: GCV_T_C" amino acids 305 to 383 (79 residues), 62.3 bits, see alignment E=3.2e-21

Best Hits

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 95% identity to vpe:Varpa_2332)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF6476 Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10) (Variovorax sp. SCN45)
VAASSAPATELLKTPLHDLHVELGARMVPFAGYSMPVQYPAGLMAEHKHTRDAAGLFDIS
HMGQLRLVGPDAAAAFETLMPVDVIDLPAGKQRYGLLLNDEGGILDDLMFFNEGNGSLFV
IVNGACKVADIAHIQQKIGARCEVQPLPDHALLALQGPQAAATLARLSPGIERFIFMTGG
AVRIGDIAAFVTRSGYTGEDGFEISVAAKDAEALARLLLAQPEVKPIGLGARNSLRLEAG
LCLYGNDIDTTTTPVEASLNWAMQKVRRAGGAREGGFPGAAKILAQLAAATAGAAGHTDH
DTLKRKRVGLVALERIPVRDGTLLQSFEGQDIGIVTSGLLGPTADRCIAMGYVATAFAEP
GTRVQAIVRGKPVPMEVSTMPFVPTRYYRG