Protein Info for GFF6470 in Variovorax sp. SCN45

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 125 (43 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 356 to 382 (27 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF06808: DctM" amino acids 7 to 414 (408 residues), 410.2 bits, see alignment E=4.6e-127 TIGR00786: TRAP transporter, DctM subunit" amino acids 18 to 418 (401 residues), 452.7 bits, see alignment E=5.3e-140

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_3297)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>GFF6470 TRAP-type C4-dicarboxylate transport system, large permease component (Variovorax sp. SCN45)
MSVVMVATMVLCFALSISVAVSIGLASILGIQVTNANMLISVKEMFNSINKFPLAAIPFF
ILAGNLMETGGISRRLVEFAKSIVGGVQGGLPMTCVLTCMIFAAVSGSSVATTFAIGAIL
IPALIKHGYPTSYAAALQATSAELGVIIPPSIPMILYGVSAEVSIGELFIAGFGPGILIS
LALMLFVWVYCKWKGWGKNDGEGRMPFGRALWQAGWALLMPVIILGGIYGGVFTPTEASA
VAVFYALVVGMVIYREIKLKDLYVILRKSVMSSAVIMFIIANAGLFAFLITRAGVPDAIG
HWLQQVLQSPAMFLLGVNAALFVIGMFIETSAAIIVLAPILAPVAVHFGIDPVHFGLIMV
VNLALGMITPPFGVNLFAACTVARISLDRIVRHLVPFVLVIMACLMVITYVPWVSLALRD
LVYAR