Protein Info for GFF647 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ferrichrome transport ATP-binding protein FhuC (TC 3.A.1.14.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 27 to 164 (138 residues), 96.3 bits, see alignment E=2.4e-31 PF13304: AAA_21" amino acids 115 to 194 (80 residues), 29.1 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 38% identical to HMUV_MYXXD: Hemin import ATP-binding protein HmuV (hmuV) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 99% identity to sty:STY0803)

Predicted SEED Role

"Ferrichrome transport ATP-binding protein FhuC (TC 3.A.1.14.3)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF647 Ferrichrome transport ATP-binding protein FhuC (TC 3.A.1.14.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRGLMLRSFSAGYSTQPVIADLNVPLLPRGKITILLGPNGCGKSTLLRSLAGLNNADGEA
LLDGEDLMSLSFAERAQKVVFLPQSLPQGVHLHVLESIIVVLRASGGRDNAQGRAQILAI
LEQLGITHLALQYLDQLSGGQRQLVGLAQSLIRRPELLLLDEPLSALDLNYQFHVMDLVR
RDTQAQNRVTIVVAHDINIALRHGDHVLMLKDGRLVASGAPETVITAERLAEVYRVRGRV
ERCSQGKLQVVLDGVIAV