Protein Info for GFF6462 in Variovorax sp. SCN45

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF00892: EamA" amino acids 2 to 111 (110 residues), 28.4 bits, see alignment E=9.3e-11 amino acids 153 to 293 (141 residues), 31.6 bits, see alignment E=9.5e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_2341)

Predicted SEED Role

"FIG00931169: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF6462 Integral membrane protein (Variovorax sp. SCN45)
LVGIAAGLGAGALWGLVFVAPRMVGHFGMVDITAARFLVFGAISGLAVFARPAAARWPNG
RQAVAALGLSVLGFSGYYLLLAFGIEAAGTEVPSLIIGTIPVWMMLLGRPAGLRLSALLP
GLVLTGAGIALMIWGAWSAQHGAGDAGGARFGWGIALALCAMASWTVYGLLNAAWLQRHT
ELNATDWANWLGVATGLGALLLWVVAGSDVATLQARPDGMLFVWIALASGFGSSWLATIL
WNIASQRLSASLCGQLIVSETLFALFYSFVWDGRWPQATEWAAALLFVLGILASIKAHR