Protein Info for GFF6459 in Variovorax sp. SCN45

Annotation: Two-component transcriptional regulatory protein BasR/PmrA (activated by BasS/PmrB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 74.9 bits, see alignment E=5.8e-25 PF00486: Trans_reg_C" amino acids 145 to 216 (72 residues), 74.5 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 39% identical to QSEB_ECOLI: Transcriptional regulatory protein QseB (qseB) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 93% identity to vpe:Varpa_2345)

Predicted SEED Role

"Transcriptional regulatory protein basR/pmrA" in subsystem Lipid A modifications or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF6459 Two-component transcriptional regulatory protein BasR/PmrA (activated by BasS/PmrB) (Variovorax sp. SCN45)
VRILLVEDDTSLADAVCSYLIAKAFVVDVAPSLADARGALLSVQYAAVLLDLHLGDGDGL
SLLPQVRALPERPIVIVLTARDQVTDRIRGLDAGADDYLIKPYDPAELLARLRAVERRRS
ASSSPVLQLGTLEIDLAHDMVRKNGAPITLTQKEWALLRVMATRPERIHTRENLADALYG
FGDEADSNTLEVFISRLRRKLGRSHIQTLRGLGYRLSFSADDDE