Protein Info for GFF6456 in Variovorax sp. SCN45

Annotation: Lipid A phosphoethanolamine transferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details PF08019: EptA_B_N" amino acids 90 to 235 (146 residues), 126.7 bits, see alignment E=7.5e-41 PF00884: Sulfatase" amino acids 266 to 564 (299 residues), 178.5 bits, see alignment E=2e-56

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 82% identity to vpe:Varpa_2348)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>GFF6456 Lipid A phosphoethanolamine transferase, putative (Variovorax sp. SCN45)
MSVLRIDPASAPQGSFPEPDPLAAASPAAPWTRFNHWLGRPRSAGAVVVWLSLYLVLTTN
WPLWSELARIGGAPSTYMPTIAVMSLLTFCGSLAILSFTAWSRWMKPLWLVVVVLAAVVQ
HYMLAYRVVMDPTMVANAMQTDPNEARDLMSWRMAFNVLVVTLPAAYLLWRVRIPPMRFL
SKLWRNVALLLLSVILALGAVVSMNRELAPLMRNNVHLRYMMNPIASLYSAGALVIKPLF
KHSGKLISITAGTALGTSYAAQTKPPLFVVVVGETARADHFSLNGYARDTNPELAKRGVL
SYREVRSCGTNTLASVPCMFSPLGKQGYESRKDDYETLVDVLQAAGLAVFWLDNQAGCKG
VCERIPNASAFAGLDAATKKALCDGDECLDDVMLKGLDERIAALPAERRAKGIVLVMHQM
GSHGPAYYKRSAPDVKRFVPECKTNALAECGHAELMNVYDNSILQTDRFLGETIDWLKGQ
TKQYDPALLYVSDHGESLGEYGLFLHGVPYSFAPDAQKHVPMVTWFSDGMSERRKLSRSC
MEAGLDAPLTHDNLYHTVLGVMDVTTPTYKPALDALASCRAKG