Protein Info for GFF6440 in Variovorax sp. SCN45

Annotation: Molybdate-binding domain of ModE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 TIGR00638: molybdenum-pterin binding domain" amino acids 1 to 68 (68 residues), 79.6 bits, see alignment E=6.7e-27 PF03459: TOBE" amino acids 4 to 66 (63 residues), 62.5 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 48% identical to MOP_HAEIN: Probable molybdenum-pterin-binding protein (HI_1370) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 58% identity to mno:Mnod_0412)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (69 amino acids)

>GFF6440 Molybdate-binding domain of ModE (Variovorax sp. SCN45)
MKISARNVLSGKVIAIVRGPVTTEVTLEIAPGVQIVSTITSNSADSLKLSEGANAYAVIK
ASSVMVGTD