Protein Info for GFF6425 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF13673: Acetyltransf_10" amino acids 24 to 117 (94 residues), 38 bits, see alignment E=3.2e-13 PF00583: Acetyltransf_1" amino acids 30 to 113 (84 residues), 55.7 bits, see alignment E=1.2e-18 PF13508: Acetyltransf_7" amino acids 32 to 114 (83 residues), 50.8 bits, see alignment E=3.7e-17

Best Hits

Swiss-Prot: 41% identical to YVBK_BACSU: Uncharacterized N-acetyltransferase YvbK (yvbK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 45% identity to bcz:BCZK1453)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>GFF6425 no description (Variovorax sp. SCN45)
MRRANPADAPPWKLLFAADGPRAEIEKYLSRGEQWLAEIDGLVVGQMVLMQTRVDIWEVM
NIAVSDELHGRGVGTALLRKAKALAAERGAQRLEVGTGNSSLRELAFYQRFGFRIVGVDV
GFFERRSKRVQKQDGIVLRDMVRLALELPAPRSPRGRSFSAPL