Protein Info for GFF6415 in Variovorax sp. SCN45

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 2 to 589 (588 residues), 736.1 bits, see alignment E=2.9e-225 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 3 to 439 (437 residues), 481.8 bits, see alignment E=2.3e-148 PF00270: DEAD" amino acids 4 to 157 (154 residues), 78 bits, see alignment E=1.9e-25 PF00271: Helicase_C" amino acids 196 to 304 (109 residues), 69.2 bits, see alignment E=9.1e-23 PF16124: RecQ_Zn_bind" amino acids 316 to 377 (62 residues), 69.4 bits, see alignment E=9.3e-23 PF09382: RQC" amino acids 379 to 494 (116 residues), 119.6 bits, see alignment E=1.5e-38 PF00570: HRDC" amino acids 523 to 587 (65 residues), 80.9 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 95% identity to vpe:Varpa_0178)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (591 amino acids)

>GFF6415 ATP-dependent DNA helicase RecQ (Variovorax sp. SCN45)
VVGGGDALVLMPTGGGKSLCYQIPAIARQRAGHGVAIVVSPLIALMHDQVGALHEAGVSA
AFLNSTLDWEETQDVERRMLRGEITLLYAAPERVNTPRFLSQLDSLKERGKLSLFAIDEA
HCVSQWGHDFRPEYRALTVLHERYAGVPRIALTATADDLTRADIVERLQLEEARQFVSSF
DRPNIRYTIVEKKDATTQLLRFIEREHEGDAGVVYCQSRKRVEDVAVTLRDAGINALPYH
AGLDAAVRQKHQDRFLREEGIVMVATIAFGMGIDKPDVRFVGHLDMPKNIEGYYQETGRA
GRDGGPADAWMAYGLQDVVNQRRMIDESPAGEEFKQVMRGKLDALLSLAEASDCRRVRLL
GYFGEKSTPCGNCDNCLNPPQVWDGTDAARKLLSTIYRVQQLSGISFGAGHIMDILRGKA
TEKVKQFGHERVSTFGIGAEFSEVALRGVLRQLIATGALAVDAEAFNTLKLTEGSRAVLR
GEAQVTLRESVSSPAERSKSRREKTVKGAPSPAAAKLDDTGKKRFEALKAWRAEVAKEHN
LPAYVIFHDATLAAIAERAPATLEDLQGISGIGTKKLEAYGSEVLRVCEAF