Protein Info for GFF641 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Rubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00301: Rubredoxin
  • amino acids 1 to 45 (45 residues), 75.3 bits, E=1.5e-25

Best Hits

Swiss-Prot: 57% identical to RUBR_ACIAD: Rubredoxin (rubA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 94% identity to pol:Bpro_1135)

MetaCyc: 59% identical to rubredoxin 1 (Mycobacterium tuberculosis H37Rv)
Alkane 1-monooxygenase. [EC: 1.14.15.3]

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

• octane oxidation (4/5 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Fatty acid metabolism
• Retinol metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.3

Protein Sequence (50 amino acids)

>GFF641 Rubredoxin (Hydrogenophaga sp. GW460-11-11-14-LB1)
MCLICGWIYDEAAGAPEHGVAAGTPWAEVPMNWTCPECGARKEDFEMVQI