Protein Info for GFF6403 in Variovorax sp. SCN45

Annotation: Stresses-induced protein Ves (HutD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details PF05962: HutD" amino acids 11 to 169 (159 residues), 182.1 bits, see alignment E=5.9e-58

Best Hits

KEGG orthology group: K09975, hypothetical protein (inferred from 83% identity to vpe:Varpa_0189)

Predicted SEED Role

"Conserved hypothetical protein (perhaps related to histidine degradation)" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>GFF6403 Stresses-induced protein Ves (HutD) (Variovorax sp. SCN45)
MSGPQRFSRTSLPAMPWKNGGGTTQEIVSWPQGAGLDSFGWRVSIATIAAAGPFSVFAGV
DRSITLLEGDGVRLFTHDGRIDHRLDVPHQPFAFSGDEAIDCTLFGGASNDFNVMTRRGQ
WRADVRVLASAAAIEAAPHGVLLALRGAWRLNDEACREGEGLRWADAAQAWQAMPEGADA
RLLAVRILPA