Protein Info for GFF6392 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 300 to 317 (18 residues), see Phobius details amino acids 360 to 375 (16 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details amino acids 464 to 482 (19 residues), see Phobius details amino acids 566 to 582 (17 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 78% identity to vpe:Varpa_0201)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>GFF6392 hypothetical protein (Variovorax sp. SCN45)
LIFAAAHYAALAVFITGSWGFGRALLGRLAPPPRRDAWLEAAMAVALGMGLFICAFQALA
VFGAFRPGATLALVVAGVAAAALQLPGWLRERRGLRMNESAAPWTHYERIAAIALALVAL
PALVAPLAPPFAFDELMYHLPYARQVAQQGTLGIHDWLRYPWFPYNYNLLYAGALQLGDD
VLPHFLNALAGALSVVMLYRLGMQHANRLTACIGAAIWLGLGDYSNALIDMGVALFVLSA
CVALWWWRESEPGKPVHGGMRWLGLAAFFLGVAAGCKYQALVFMPLVALFVVRHERSPKA
WGLALVCFLLPCIYWYARNFVMTGDPFNPIGARIFGFTEWTPADYVQQVADVRVHAEMPN
ALIWSFFLAPFSVLWKRSAAVRAAGWFCFYSVAVWVVTSRYPRYLMASFPLLAVTSAIGW
QVLFGWISSGLRRVFGAKAPGEATAATGATGAMSRDTARAGARVGDWAAVLLLAVLAAVS
VRQTAVKVSMISITPEAREAFLRKHVPGYAAMDYLRRNATGRVYQIALNEAIYYGPNPVW
GDTLGPWRYTDFGKLSGGDLARKLTGLGFVAVVLPDAVVPVFSARVDFDKYFAVQFEQDG
SRVYRILPVAP