Protein Info for GFF6391 in Variovorax sp. SCN45

Annotation: RfbJ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 240 to 263 (24 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 13 to 209 (197 residues), 29.6 bits, see alignment E=5.9e-11 PF00535: Glycos_transf_2" amino acids 16 to 170 (155 residues), 63 bits, see alignment E=3.4e-21

Best Hits

KEGG orthology group: None (inferred from 83% identity to vpe:Varpa_0202)

Predicted SEED Role

"RfbJ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>GFF6391 RfbJ protein (Variovorax sp. SCN45)
MTDADLHTRRPLRIAVVIPCYNEALAVAQVVEGFRAALPEAEVHVFDNNSSDDTTAVARA
AGAVVTHVAARGKGNVVRRMFADVEADVYVMADGDATYDATAARRLIDRLVEGNLDMVVG
NRVDDGQNALTYRAGHRFGNRLLTGAVVQLFGGGLTDMLSGYRVFSRRYAKSFPALSRGF
EIETELTVHALELRMPYAEESTAYSTRPEGSESKLSTYRDGWRILKTICKLFVSERPLQF
FSIIGGILVALSVVLAAPLFMTYMQTGLVPRLPTAVLVTGAMLAAMLSFVCGIVMHTVTL
GRQEAKRLCYLSVPGVRESVRK